Lineage for d4o4le_ (4o4l E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2733976Domain d4o4le_: 4o4l E: [238034]
    Other proteins in same PDB: d4o4la1, d4o4la2, d4o4lb1, d4o4lb2, d4o4lc1, d4o4lc2, d4o4ld1, d4o4ld2, d4o4lf1, d4o4lf2
    automated match to d4i4te_
    complexed with ca, ep, gdp, gtp, mes, mg, pou

Details for d4o4le_

PDB Entry: 4o4l (more details), 2.2 Å

PDB Description: Tubulin-Peloruside A-Epothilone A complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4o4le_:

Sequence, based on SEQRES records: (download)

>d4o4le_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeea

Sequence, based on observed residues (ATOM records): (download)

>d4o4le_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eea

SCOPe Domain Coordinates for d4o4le_:

Click to download the PDB-style file with coordinates for d4o4le_.
(The format of our PDB-style files is described here.)

Timeline for d4o4le_: