Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Thermotoga maritima [TaxId:2336] [51805] (1 PDB entry) |
Domain d1hdgq1: 1hdg Q:1-148,Q:313-331 [29991] Other proteins in same PDB: d1hdgo2, d1hdgq2 complexed with nad, so4 |
PDB Entry: 1hdg (more details), 2.5 Å
SCOPe Domain Sequences for d1hdgq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdgq1 c.2.1.3 (Q:1-148,Q:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit apakgeditvvigcnedqlkpehtiiscasXneygysnrvvdtlelllkm
Timeline for d1hdgq1: