Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Thermotoga maritima [TaxId:2336] [55353] (1 PDB entry) |
Domain d1hdgq2: 1hdg Q:149-312 [39906] Other proteins in same PDB: d1hdgo1, d1hdgq1 complexed with nad, so4 |
PDB Entry: 1hdg (more details), 2.5 Å
SCOPe Domain Sequences for d1hdgq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hdgq2 d.81.1.1 (Q:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} cttnsiapivkvlhekfgivsgmlttvhsytndqrvldlphkdlrraraaavniiptttg aakavalvvpevkgkldgmairvptpdgsitdltvlvekettveevnavmkeategrlkg iigyndepivssdiigttfsgifdatitnviggklvkvaswyd
Timeline for d1hdgq2: