SCOPe 2.08: Domain d4m0wa2: 4m0w A:63-319

Lineage for d4m0wa2 (4m0w A:63-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein automated matches [310868] (6 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [311282] (4 PDB entries)

8. Domain d4m0wa2: 4m0w A:63-319 [299381]
   Other proteins in same PDB: d4m0wa1, d4m0wb_
   automated match to d2fe8a2
   complexed with gol, na, nhe, zn; mutant

Details for d4m0wa2

PDB Entry: 4m0w, 1.4 Å

PDB Description: Crystal Structure of SARS-CoV papain-like protease C112S mutant in complex with ubiquitin

PDB Compounds: (A:) Replicase polyprotein 1a

SCOPe Domain Sequences for d4m0wa2:

Sequence; same for both SEQRES and ATOM records:

>d4m0wa2 d.3.1.23 (A:63-319) automated matches {SARS coronavirus [TaxId: 227859]}
dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnnsylssvllalq
qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa
krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf
vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt
dvfyketsytttikpvs

Timeline for d4m0wa2:

• d4m0wa2 first appeared in SCOPe 2.06
  
• d4m0wa2 appears in SCOPe 2.07