SCOPe 2.07: Domain d1b15a_: 1b15 A:

Lineage for d1b15a_ (1b15 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Drosophila alcohol dehydrogenase [51782] (2 species)

7. Species Fly (Drosophila lebanonensis) [TaxId:7225] [51783] (8 PDB entries)

8. Domain d1b15a_: 1b15 A: [29880]
   complexed with nae

Details for d1b15a_

PDB Entry: 1b15, 2.2 Å

PDB Description: alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone

PDB Compounds: (A:) alcohol dehydrogenase

SCOPe Domain Sequences for d1b15a_:

Sequence; same for both SEQRES and ATOM records:

>d1b15a_ c.2.1.2 (A:) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

Timeline for d1b15a_:

• d1b15a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b15a_ appears in SCOPe 2.06
  
• d1b15a_ appears in the current release, SCOPe 2.08