Lineage for d1b15a_ (1b15 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20100Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (21 protein domains)
  6. 20171Protein Drosophila alcohol dehydrogenase [51782] (1 species)
  7. 20172Species Fruit fly (Drosophila lebanonensis) [51783] (5 PDB entries)
  8. 20178Domain d1b15a_: 1b15 A: [29880]

Details for d1b15a_

PDB Entry: 1b15 (more details), 2.2 Å

PDB Description: alcohol dehydrogenase from drosophila lebanonensis ternary complex with nad-acetone

SCOP Domain Sequences for d1b15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b15a_ c.2.1.2 (A:) Drosophila alcohol dehydrogenase {Fruit fly (Drosophila lebanonensis)}
mdltnknvifvaalggigldtsrelvkrnlknfvildrvenptalaelkainpkvnitfh
tydvtvpvaeskkllkkifdqlktvdilingagilddhqiertiainftglvntttaild
fwdkrkggpggiianicsvtgfnaihqvpvysaskaavvsftnslaklapitgvtaysin
pgitrtplvhtfnswldveprvaelllshptqtseqcgqnfvkaieankngaiwkldlgt
leaiewtkhwdshi

SCOP Domain Coordinates for d1b15a_:

Click to download the PDB-style file with coordinates for d1b15a_.
(The format of our PDB-style files is described here.)

Timeline for d1b15a_: