Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (31 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein 7-alpha-hydroxysteroid dehydrogenase [51774] (1 species) |
Species Escherichia coli [TaxId:562] [51775] (3 PDB entries) |
Domain d1ahhb_: 1ahh B: [29861] complexed with nad |
PDB Entry: 1ahh (more details), 2.3 Å
SCOP Domain Sequences for d1ahhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahhb_ c.2.1.2 (B:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli} mfnsdnlrldgkcaiitgagagigkeiaitfatagasvvvsdinadaanhvvdeiqqlgg qafacrcditseqelsaladfaisklgkvdilvnnaggggpkpfdmpmadfrrayelnvf sffhlsqlvapemekngggviltitsmaaenkninmtsyasskaaashlvrnmafdlgek nirvngiapgailtdalksvitpeieqkmlqhtpirrlgqpqdianaalflcspaaswvs gqiltvsgggvqe
Timeline for d1ahhb_: