| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.9: Tubulin tyrosine ligase (TTL) N-terminal domain-like [310625] (1 protein) |
| Protein Tubulin tyrosine ligase (TTL) N-terminal domain [310727] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [311384] (188 PDB entries) |
| Domain d4ihjf1: 4ihj F:1-76 [298391] Other proteins in same PDB: d4ihja1, d4ihja2, d4ihjb1, d4ihjb2, d4ihjc1, d4ihjc2, d4ihjd1, d4ihjd2, d4ihje_, d4ihjf2, d4ihjf3 automated match to d3tiia1 complexed with adp, ca, cl, gdp, gol, gtp, mes, mg |
PDB Entry: 4ihj (more details), 2 Å
SCOPe Domain Sequences for d4ihjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ihjf1 c.30.1.9 (F:1-76) Tubulin tyrosine ligase (TTL) N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas
Timeline for d4ihjf1: