![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein Stathmin 4 [101496] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
![]() | Domain d4ihje_: 4ihj E: [194008] Other proteins in same PDB: d4ihja1, d4ihja2, d4ihjb1, d4ihjb2, d4ihjc1, d4ihjc2, d4ihjd1, d4ihjd2, d4ihjf1, d4ihjf2, d4ihjf3 automated match to d3ryce_ complexed with adp, ca, cl, gdp, gol, gtp, mes, mg |
PDB Entry: 4ihj (more details), 2 Å
SCOPe Domain Sequences for d4ihje_:
Sequence, based on SEQRES records: (download)
>d4ihje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d4ihje_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d4ihje_: