Lineage for d1bxzd2 (1bxz D:140-313)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449373Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2449615Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
  7. 2449633Species Thermoanaerobacter brockii [TaxId:29323] [51744] (3 PDB entries)
  8. 2449645Domain d1bxzd2: 1bxz D:140-313 [29780]
    Other proteins in same PDB: d1bxza1, d1bxzb1, d1bxzc1, d1bxzd1
    complexed with cl, mg, sbt, zn

Details for d1bxzd2

PDB Entry: 1bxz (more details), 2.99 Å

PDB Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
PDB Compounds: (D:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1bxzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxzd2 c.2.1.1 (D:140-313) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
ipleaavmipdmmttgfhgaeladielgatvavlgigpvglmavagaklrgagriiavgs
rpvcvdaakyygatdivnykdgpiesqimnltegkgvdaaiiaggnadimatavkivkpg
gtianvnyfgegevlpvprlewgcgmahktikgglcpggrlrmerlidlvfykr

SCOPe Domain Coordinates for d1bxzd2:

Click to download the PDB-style file with coordinates for d1bxzd2.
(The format of our PDB-style files is described here.)

Timeline for d1bxzd2: