Lineage for d1bxzc1 (1bxz C:1-139,C:314-352)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meanderSuperfamily b.35.1: GroES-like [50129] (3 families) 
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species) 
Species Thermoanaerobacter brockii [TaxId:29323] [50144] (3 PDB entries) 
Domain d1bxzc1: 1bxz C:1-139,C:314-352 [24763]
Other proteins in same PDB: d1bxza2, d1bxzb2, d1bxzc2, d1bxzd2
complexed with cl, mg, sbt, zn
Details for d1bxzc1
PDB Entry: 1bxz (more details), 2.99 Å
PDB Description: crystal structure of a thermophilic alcohol dehydrogenase substrate complex from thermoanaerobacter brockii
PDB Compounds: (C:) NADP-dependent alcohol dehydrogenaseSCOPe Domain Sequences for d1bxzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bxzc1 b.35.1.2 (C:1-139,C:314-352) Bacterial secondary alcohol dehydrogenase {Thermoanaerobacter brockii [TaxId: 29323]}
mkgfamlsigkvgwiekekpapgpfdaivrplavapctsdihtvfegaigerhnmilghe
avgevvevgsevkdfkpgdrvvvpaitpdwrtsevqrgyhqhsggmlagwkfsnvkdgvf
geffhvndadmnlahlpkeXvdpsklvthvfrgfdniekafmlmkdkpkdlikpvvila
SCOPe Domain Coordinates for d1bxzc1:
Click to download the PDB-style file with coordinates for d1bxzc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bxzc1:
View in 3D
