SCOPe 2.01: Domain d1pedb2: 1ped B:140-313

Lineage for d1pedb2 (1ped B:140-313)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins)
N-terminal all-beta domain defines family
Protein Bacterial secondary alcohol dehydrogenase [51742] (2 species)
Species Clostridium beijerinckii [TaxId:1520] [51743] (3 PDB entries)
Domain d1pedb2: 1ped B:140-313 [29770]
Other proteins in same PDB: d1peda1, d1pedb1, d1pedc1, d1pedd1
complexed with zn

Details for d1pedb2

PDB Entry: 1ped (more details), 2.15 Å

PDB Description: bacterial secondary alcohol dehydrogenase (apo-form)

PDB Compounds: (B:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1pedb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pedb2 c.2.1.1 (B:140-313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mplenavmitdmmttgfhgaeladiqmgssvvvigigavglmgiagaklrgagriigvgs
rpicveaakfygatdilnyknghivdqvmkltngkgvdrvimagggsetlsqavsmvkpg
giisninyhgsgdalliprvewgcgmahktikgglcpggrlraemlrdmvvynr

SCOPe Domain Coordinates for d1pedb2:

Click to download the PDB-style file with coordinates for d1pedb2.
(The format of our PDB-style files is described here.)

Timeline for d1pedb2: