Lineage for d1qpnb1 (1qpn B:617-785)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575461Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 1575462Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)
  6. 1575481Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 1575482Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries)
  8. 1575502Domain d1qpnb1: 1qpn B:617-785 [29580]
    Other proteins in same PDB: d1qpna2, d1qpnb2, d1qpnc2, d1qpnd2, d1qpne2, d1qpnf2
    complexed with ncn

Details for d1qpnb1

PDB Entry: 1qpn (more details), 2.6 Å

PDB Description: Quinolinate Phosphoribosyl Transferase from Mycobacterium Tuberculosis in Complex with NCNN
PDB Compounds: (B:) protein (quinolinate phosphoribosyl transferase)

SCOPe Domain Sequences for d1qpnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qpnb1 c.1.17.1 (B:617-785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}
iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv
aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr
dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm

SCOPe Domain Coordinates for d1qpnb1:

Click to download the PDB-style file with coordinates for d1qpnb1.
(The format of our PDB-style files is described here.)

Timeline for d1qpnb1: