Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [51694] (4 PDB entries) |
Domain d1qpnb1: 1qpn B:617-785 [29580] Other proteins in same PDB: d1qpna2, d1qpnb2, d1qpnc2, d1qpnd2, d1qpne2, d1qpnf2 complexed with ncn |
PDB Entry: 1qpn (more details), 2.6 Å
SCOPe Domain Sequences for d1qpnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qpnb1 c.1.17.1 (B:617-785) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} iatataawvdavrgtkakirdtrktlpglralqkyavrtgggvnhrlglgdaalikdnhv aaagsvvdalravrnaapdlpcevevdsleqldavlpekpelilldnfavwqtqtavqrr dsraptvmlessgglslqtaatyaetgvdylavgalthsvrvldigldm
Timeline for d1qpnb1: