| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51690] (1 family) ![]() imcomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
| Family c.1.17.1: Quinolinic acid phosphoribosyltransferase, C-terminal domain [51691] (1 protein) |
| Protein Quinolinic acid phosphoribosyltransferase, C-terminal domain [51692] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [51693] (1 PDB entry) |
| Domain d1qapb1: 1qap B:130-296 [29560] Other proteins in same PDB: d1qapa2, d1qapb2 complexed with ntm |
PDB Entry: 1qap (more details), 2.8 Å
SCOP Domain Sequences for d1qapb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qapb1 c.1.17.1 (B:130-296) Quinolinic acid phosphoribosyltransferase, C-terminal domain {Salmonella typhimurium}
vasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdaflikenhi
iasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavkrv
ngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc
Timeline for d1qapb1: