![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
![]() | Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) |
![]() | Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [51693] (1 PDB entry) |
![]() | Domain d1qapb1: 1qap B:130-296 [29560] Other proteins in same PDB: d1qapa2, d1qapb2 complexed with ntm |
PDB Entry: 1qap (more details), 2.8 Å
SCOPe Domain Sequences for d1qapb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qapb1 c.1.17.1 (B:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} vasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdaflikenhi iasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavkrv ngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc
Timeline for d1qapb1: