Lineage for d1qapb1 (1qap B:130-296)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839615Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins)
  6. 2839634Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species)
  7. 2839660Species Salmonella typhimurium [TaxId:90371] [51693] (1 PDB entry)
  8. 2839662Domain d1qapb1: 1qap B:130-296 [29560]
    Other proteins in same PDB: d1qapa2, d1qapb2
    complexed with ntm

Details for d1qapb1

PDB Entry: 1qap (more details), 2.8 Å

PDB Description: quinolinic acid phosphoribosyltransferase with bound quinolinic acid
PDB Compounds: (B:) quinolinic acid phosphoribosyltransferase

SCOPe Domain Sequences for d1qapb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qapb1 c.1.17.1 (B:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]}
vasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdaflikenhi
iasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavkrv
ngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc

SCOPe Domain Coordinates for d1qapb1:

Click to download the PDB-style file with coordinates for d1qapb1.
(The format of our PDB-style files is described here.)

Timeline for d1qapb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qapb2