PDB entry 1qap

View 1qap on RCSB PDB site
Description: quinolinic acid phosphoribosyltransferase with bound quinolinic acid
Class: glycosyltransferase
Keywords: glycosyltransferase, quinolinic acid, nad biosynthesis
Deposited on 1996-09-20, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.186
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30012 (Start-295)
      • conflict (106)
    Domains in SCOPe 2.08: d1qapa1, d1qapa2
  • Chain 'B':
    Compound: quinolinic acid phosphoribosyltransferase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30012 (Start-295)
      • conflict (106)
    Domains in SCOPe 2.08: d1qapb1, d1qapb2
  • Heterogens: NTM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qapA (A:)
    pprrynpddrrdallerinldipaavaqalredlggevdagnditaqllpadtqahatvi
    tredgvfcgkrwveevfiqlagddvrltwhvddgdaihanqtvfelqgparvlltgerta
    lnfvqtlsgvasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltd
    aflikenhiiasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntd
    qmreavkrvngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qapA (A:)
    ddrrdallerinldipaavaqalredlggevdagnditaqllpadtqahatvitredgvf
    cgkrwveevfiqlagddvrltwhvddgdaihanqtvfelqgparvlltgertalnfvqtl
    sgvasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdafliken
    hiiasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavk
    rvngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qapB (B:)
    pprrynpddrrdallerinldipaavaqalredlggevdagnditaqllpadtqahatvi
    tredgvfcgkrwveevfiqlagddvrltwhvddgdaihanqtvfelqgparvlltgerta
    lnfvqtlsgvasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltd
    aflikenhiiasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntd
    qmreavkrvngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qapB (B:)
    ddrrdallerinldipaavaqalredlggevdagnditaqllpadtqahatvitredgvf
    cgkrwveevfiqlagddvrltwhvddgdaihanqtvfelqgparvlltgertalnfvqtl
    sgvasevrryvgllagtqtqlldtrktlpglrtalkyavlcggganhrlgltdafliken
    hiiasgsvrqavekafwlhpdvpvevevenldelddalkagadiimldnfntdqmreavk
    rvngqarlevsgnvtaetlrefaetgvdfisvgaltkhvraldlsmrfc