| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) ![]() Pfam PF16454 |
| Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
| Protein automated matches [310859] (2 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [311310] (9 PDB entries) |
| Domain d3l4qd_: 3l4q D: [293440] Other proteins in same PDB: d3l4qa_, d3l4qb_ automated match to d2v1yb_ complexed with gol |
PDB Entry: 3l4q (more details), 2.3 Å
SCOPe Domain Sequences for d3l4qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4qd_ h.4.21.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeq
gqtqeksskeylerfrregnekemqrillnserlksriaeihesrtkleqelraqasdnr
eidkrmnslkpdlmqlrkirdqylvwltqkgarqkkinewlgi
Timeline for d3l4qd_: