Lineage for d3l4qd_ (3l4q D:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042445Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 3042446Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 3042450Protein automated matches [310859] (2 species)
    not a true protein
  7. 3042451Species Cow (Bos taurus) [TaxId:9913] [311310] (7 PDB entries)
  8. 3042454Domain d3l4qd_: 3l4q D: [293440]
    Other proteins in same PDB: d3l4qa_, d3l4qb_
    automated match to d2v1yb_
    complexed with gol

Details for d3l4qd_

PDB Entry: 3l4q (more details), 2.3 Å

PDB Description: structural insights into phosphoinositide 3-kinase activation by the influenza a virus ns1 protein
PDB Compounds: (D:) Phosphatidylinositol 3-kinase regulatory subunit beta

SCOPe Domain Sequences for d3l4qd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4qd_ h.4.21.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeq
gqtqeksskeylerfrregnekemqrillnserlksriaeihesrtkleqelraqasdnr
eidkrmnslkpdlmqlrkirdqylvwltqkgarqkkinewlgi

SCOPe Domain Coordinates for d3l4qd_:

Click to download the PDB-style file with coordinates for d3l4qd_.
(The format of our PDB-style files is described here.)

Timeline for d3l4qd_: