Lineage for d1pkyb2 (1pky B:1-69,B:168-344)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 115904Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 117377Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 117378Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 117379Protein Pyruvate kinase, N-terminal domain [51623] (5 species)
  7. 117387Species Escherichia coli [TaxId:562] [51628] (3 PDB entries)
  8. 117393Domain d1pkyb2: 1pky B:1-69,B:168-344 [29297]
    Other proteins in same PDB: d1pkya1, d1pkya3, d1pkyb1, d1pkyb3, d1pkyc1, d1pkyc3, d1pkyd1, d1pkyd3

Details for d1pkyb2

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkyb2 c.1.12.1 (B:1-69,B:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli}
mkktkivctigpkteseemlakmldagmnvmrlnfshgdyaehgqriqnlrnvmsktgkt
aailldtkgXpalaekdkqdlifgceqgvdfvaasfirkrsdvieirehlkahggenihi
iskienqeglnnfdeileasdgimvargdlgveipveevifaqkmmiekcirarkvvita
tmmldsmiknprptraeagdvanaildgtdavmlsgesakgkypleavsimaticertdr
vmnsrle

SCOP Domain Coordinates for d1pkyb2:

Click to download the PDB-style file with coordinates for d1pkyb2.
(The format of our PDB-style files is described here.)

Timeline for d1pkyb2: