Lineage for d1pkya1 (1pky A:70-167)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113337Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 113338Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 113339Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
  6. 113340Protein Pyruvate kinase (PK) [50802] (5 species)
  7. 113348Species Escherichia coli [TaxId:562] [50807] (3 PDB entries)
  8. 113353Domain d1pkya1: 1pky A:70-167 [27068]
    Other proteins in same PDB: d1pkya2, d1pkya3, d1pkyb2, d1pkyb3, d1pkyc2, d1pkyc3, d1pkyd2, d1pkyd3

Details for d1pkya1

PDB Entry: 1pky (more details), 2.5 Å

PDB Description: pyruvate kinase from e. coli in the t-state

SCOP Domain Sequences for d1pkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pkya1 b.58.1.1 (A:70-167) Pyruvate kinase (PK) {Escherichia coli}
peirtmkleggndvslkagqtftfttdksvignsemvavtyegfttdlsvgntvlvddgl
igmevtaiegnkvickvlnngdlgenkgvnlpgvsial

SCOP Domain Coordinates for d1pkya1:

Click to download the PDB-style file with coordinates for d1pkya1.
(The format of our PDB-style files is described here.)

Timeline for d1pkya1: