Class j: Peptides [58231] (148 folds) |
Fold j.135: Sac3 CID region-like [310572] (1 superfamily) |
Superfamily j.135.1: Sac3 CID region-like [310604] (1 family) interactions with Sus1, Cdc31 described in PubMed 19328066 |
Family j.135.1.1: Sac3 CID region-like [310654] (2 proteins) |
Protein Nuclear mRNA export protein Sac3 [310816] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311082] (1 PDB entry) |
Domain d3fwbb_: 3fwb B: [292326] Other proteins in same PDB: d3fwba_, d3fwbc_ protein/RNA complex |
PDB Entry: 3fwb (more details), 2.5 Å
SCOPe Domain Sequences for d3fwbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fwbb_ j.135.1.1 (B:) Nuclear mRNA export protein Sac3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} seanyrkdfidtmtrelydaflherlyliymdsraelkrnstlkkkffekwqas
Timeline for d3fwbb_: