Lineage for d3fwbb_ (3fwb B:)

  1. Root: SCOPe 2.07
  2. 2596047Class j: Peptides [58231] (148 folds)
  3. 2598042Fold j.135: Sac3 CID region-like [310572] (1 superfamily)
  4. 2598043Superfamily j.135.1: Sac3 CID region-like [310604] (1 family) (S)
    interactions with Sus1, Cdc31 described in PubMed 19328066
  5. 2598044Family j.135.1.1: Sac3 CID region-like [310654] (2 protein domains)
  6. 2598049Protein Nuclear mRNA export protein Sac3 [310816] (1 species)
  7. 2598050Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311082] (1 PDB entry)
  8. 2598051Domain d3fwbb_: 3fwb B: [292326]
    Other proteins in same PDB: d3fwba_, d3fwbc_
    protein/RNA complex

Details for d3fwbb_

PDB Entry: 3fwb (more details), 2.5 Å

PDB Description: Sac3:Sus1:Cdc31 complex
PDB Compounds: (B:) Nuclear mRNA export protein SAC3

SCOPe Domain Sequences for d3fwbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fwbb_ j.135.1.1 (B:) Nuclear mRNA export protein Sac3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
seanyrkdfidtmtrelydaflherlyliymdsraelkrnstlkkkffekwqas

SCOPe Domain Coordinates for d3fwbb_:

Click to download the PDB-style file with coordinates for d3fwbb_.
(The format of our PDB-style files is described here.)

Timeline for d3fwbb_: