Lineage for d1ucwb_ (1ucw B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834930Protein Transaldolase [51588] (3 species)
    probably related to class I aldolases by a circular permutation
  7. 2834931Species Escherichia coli [TaxId:562] [51589] (7 PDB entries)
  8. 2834935Domain d1ucwb_: 1ucw B: [29172]
    has additional insertions and/or extensions that are not grouped together

Details for d1ucwb_

PDB Entry: 1ucw (more details), 2.2 Å

PDB Description: complex of transaldolase with the reduced schiff-base intermediate
PDB Compounds: (B:) Transaldolase

SCOPe Domain Sequences for d1ucwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucwb_ c.1.10.1 (B:) Transaldolase {Escherichia coli [TaxId: 562]}
tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvgr
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll

SCOPe Domain Coordinates for d1ucwb_:

Click to download the PDB-style file with coordinates for d1ucwb_.
(The format of our PDB-style files is described here.)

Timeline for d1ucwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ucwa_