PDB entry 1ucw

View 1ucw on RCSB PDB site
Description: complex of transaldolase with the reduced schiff-base intermediate
Class: transferase
Keywords: transferase, ketone residues, pentose shunt
Deposited on 1996-11-14, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transaldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A870 (1-316)
      • modified residue (131)
    Domains in SCOPe 2.08: d1ucwa_
  • Chain 'B':
    Compound: Transaldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A870 (1-316)
      • modified residue (131)
    Domains in SCOPe 2.08: d1ucwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ucwA (A:)
    mtdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawak
    qqsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklyn
    dagisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvg
    rildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcd
    rltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegir
    kfaidqeklekmigdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucwA (A:)
    tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
    qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
    agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvgr
    ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
    ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
    faidqeklekmigdll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ucwB (B:)
    mtdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawak
    qqsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklyn
    dagisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvg
    rildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcd
    rltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegir
    kfaidqeklekmigdll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ucwB (B:)
    tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
    qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
    agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvflispfvgr
    ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
    ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
    faidqeklekmigdll