Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Type I 3-dehydroquinate dehydratase [51586] (4 species) |
Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries) |
Domain d1qfea_: 1qfe A: [29167] complexed with dhs |
PDB Entry: 1qfe (more details), 2.1 Å
SCOPe Domain Sequences for d1qfea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qfea_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn dlrsvlmilhna
Timeline for d1qfea_: