Lineage for d1qfea_ (1qfe A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834951Protein Type I 3-dehydroquinate dehydratase [51586] (4 species)
  7. 2834973Species Salmonella typhi [TaxId:90370] [51587] (3 PDB entries)
  8. 2834974Domain d1qfea_: 1qfe A: [29167]
    complexed with dhs

Details for d1qfea_

PDB Entry: 1qfe (more details), 2.1 Å

PDB Description: the structure of type i 3-dehydroquinate dehydratase from salmonella typhi
PDB Compounds: (A:) protein (3-dehydroquinate dehydratase)

SCOPe Domain Sequences for d1qfea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qfea_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]}
mktvtvknliigegmpkiivslmgrdinsvkaealayreatfdilewrvdhfmdiastqs
vltaarvirdampdipllftfrsakeggeqtittqhyltlnraaidsglvdmidlelftg
dadvkatvdyahahnvyvvmsnhdfhqtpsaeemvsrlrkmqalgadipkiavmpqskhd
vltlltatlemqqhyadrpvitmsmakegvisrlagevfgsaatfgavkqasapgqiavn
dlrsvlmilhna

SCOPe Domain Coordinates for d1qfea_:

Click to download the PDB-style file with coordinates for d1qfea_.
(The format of our PDB-style files is described here.)

Timeline for d1qfea_: