Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Fructose-1,6-bisphosphate aldolase [51576] (10 species) |
Species Human (Homo sapiens), muscle isozyme [TaxId:9606] [51577] (3 PDB entries) |
Domain d1alda_: 1ald A: [29100] |
PDB Entry: 1ald (more details), 2 Å
SCOP Domain Sequences for d1alda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1alda_ c.1.10.1 (A:) Fructose-1,6-bisphosphate aldolase {Human (Homo sapiens), muscle isozyme [TaxId: 9606]} pyqypaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrq llltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtng etttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqn givpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghact qkfsheeiamatvtalrrtvppavtgitflsggqseeeasinlnainkcpllkpwaltfs ygralqasalkawggkkenlkaaqeeyvkralanslacqgkytpsgqagaaaseslfvsn hay
Timeline for d1alda_: