Lineage for d1f6pa_ (1f6p A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1821672Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 1822086Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 1822104Species Haemophilus influenzae [TaxId:727] [51573] (6 PDB entries)
  8. 1822119Domain d1f6pa_: 1f6p A: [29093]

Details for d1f6pa_

PDB Entry: 1f6p (more details), 2.25 Å

PDB Description: crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii
PDB Compounds: (A:) n-acetyl neuraminate lyase

SCOPe Domain Sequences for d1f6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6pa_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]}
mrdlkgifsallvsfnedgtinekglrqiirhnidkmkvdglyvggstgenfmlsteekk
eifriakdeakdqialiaqvgsvnlkeavelgkyatelgydclsavtpfyykfsfpeikh
yydtiiaetgsnmivysipfltgvnmgieqfgelyknpkvlgvkftagdfyllerlkkay
pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltkagklkealeiqhvtnd
liegilanglyltikellklegvdagycrepmtskataeqvakakdlkakfls

SCOPe Domain Coordinates for d1f6pa_:

Click to download the PDB-style file with coordinates for d1f6pa_.
(The format of our PDB-style files is described here.)

Timeline for d1f6pa_: