Lineage for d1f7ba_ (1f7b A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 572455Superfamily c.1.10: Aldolase [51569] (6 families) (S)
    Common fold covers whole protein structure
  5. 572456Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 572682Protein N-acetylneuraminate lyase [51571] (2 species)
  7. 572700Species Haemophilus influenzae [TaxId:727] [51573] (6 PDB entries)
  8. 572705Domain d1f7ba_: 1f7b A: [29083]

Details for d1f7ba_

PDB Entry: 1f7b (more details), 1.8 Å

PDB Description: crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid

SCOP Domain Sequences for d1f7ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f7ba_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae}
mrdlkgifsallvsfnedgtinekglrqiirhnidkmkvdglyvggstgenfmlsteekk
eifriakdeakdqialiaqvgsvnlkeavelgkyatelgydclsavtpfyykfsfpeikh
yydtiiaetgsnmivysipfltgvnmgieqfgelyknpkvlgvkftagdfyllerlkkay
pnhliwagfdemmlpaaslgvdgaigstfnvngvrarqifeltkagklkealeiqhvtnd
liegilanglyltikellklegvdagycrepmtskataeqvakakdlkakfls

SCOP Domain Coordinates for d1f7ba_:

Click to download the PDB-style file with coordinates for d1f7ba_.
(The format of our PDB-style files is described here.)

Timeline for d1f7ba_: