Lineage for d1ejsc2 (1ejs C:1130-1422,C:1476-1567)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2442004Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2442071Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 2442072Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 2442091Species Klebsiella aerogenes [TaxId:28451] [51562] (28 PDB entries)
  8. 2442104Domain d1ejsc2: 1ejs C:1130-1422,C:1476-1567 [29046]
    Other proteins in same PDB: d1ejsa_, d1ejsb_, d1ejsc1
    complexed with ni

Details for d1ejsc2

PDB Entry: 1ejs (more details), 2 Å

PDB Description: crystal structure of the h219n variant of klebsiella aerogenes urease
PDB Compounds: (C:) urease alpha subunit

SCOPe Domain Sequences for d1ejsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejsc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkinedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d1ejsc2:

Click to download the PDB-style file with coordinates for d1ejsc2.
(The format of our PDB-style files is described here.)

Timeline for d1ejsc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejsc1