Lineage for d1ejsc2 (1ejs C:1130-1422,C:1476-1567)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 19134Superfamily c.1.9: Metallo-dependent hydrolases [51556] (3 families) (S)
  5. 19152Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 19153Protein alpha-subunit of urease, catalytic domain [51561] (2 species)
  7. 19159Species Klebsiella aerogenes [TaxId:28451] [51562] (25 PDB entries)
  8. 19172Domain d1ejsc2: 1ejs C:1130-1422,C:1476-1567 [29046]
    Other proteins in same PDB: d1ejsa_, d1ejsb_, d1ejsc1

Details for d1ejsc2

PDB Entry: 1ejs (more details), 2 Å

PDB Description: Crystal Structure of the H219N Variant of Klebsiella Aerogenes Urease

SCOP Domain Sequences for d1ejsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ejsc2 c.1.9.2 (C:1130-1422,C:1476-1567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkinedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOP Domain Coordinates for d1ejsc2:

Click to download the PDB-style file with coordinates for d1ejsc2.
(The format of our PDB-style files is described here.)

Timeline for d1ejsc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ejsc1