Lineage for d1e4na_ (1e4n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083019Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 2083022Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (9 PDB entries)
    Uniprot P49235
  8. 2083037Domain d1e4na_: 1e4n A: [28936]
    complexed with hbo; mutant

Details for d1e4na_

PDB Entry: 1e4n (more details), 2.1 Å

PDB Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta-glucosidase zmglu e191d in complex with the natural aglycone dimboa
PDB Compounds: (A:) Beta-glucosidase

SCOPe Domain Sequences for d1e4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4na_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1 [TaxId: 4577]}
lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi
gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen
giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp
qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd
dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf
fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp
pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld
yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa
kwlkefnta

SCOPe Domain Coordinates for d1e4na_:

Click to download the PDB-style file with coordinates for d1e4na_.
(The format of our PDB-style files is described here.)

Timeline for d1e4na_: