Lineage for d1e4nb_ (1e4n B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins)
  6. Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. Species Maize (Zea mays), zmglu1 [TaxId:4577] [51525] (9 PDB entries)
    Uniprot P49235
  8. Domain d1e4nb_: 1e4n B: [28937]
    complexed with hbo; mutant

Details for d1e4nb_

PDB Entry: 1e4n (more details), 2.1 Å

PDB Description: crystal structure of the inactive mutant monocot (maize zmglu1) beta-glucosidase zmglu e191d in complex with the natural aglycone dimboa
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d1e4nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4nb_ c.1.8.4 (B:) Plant beta-glucosidase (myrosinase) {Maize (Zea mays), zmglu1 [TaxId: 4577]}
lspseipqrdwfpsdftfgaatsayqiegawnedgkgesnwdhfchnhperildgsnsdi
gansyhmyktdvrllkemgmdayrfsiswprilpkgtkegginpdgikyyrnlinlllen
giepyvtifhwdvpqaleekyggfldkshksivedytyfakvcfdnfgdkvknwltfndp
qtftsfsygtgvfapgrcspgldcayptgnslvepytaghnillahaeavdlynkhykrd
dtriglafdvmgrvpygtsfldkqaeerswdinlgwflepvvrgdypfsmrslarerlpf
fkdeqkeklagsynmlglnyytsrfsknidispnyspvlntddayasqevngpdgkpigp
pmgnpwiymypeglkdllmimknkygnppiyitengigdvdtketplpmeaalndykrld
yiqrhiatlkesidlgsnvqgyfawslldnfewfagfterygivyvdrnnnctrymkesa
kwlkefnta

SCOPe Domain Coordinates for d1e4nb_ are not available.

Timeline for d1e4nb_:

Domains from other chains:
(mouse over for more information)
d1e4na_