Lineage for d1cbga_ (1cbg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083019Protein Plant beta-glucosidase (myrosinase) [51522] (4 species)
  7. 2083020Species Creeping white clover (Trifolium repens) [TaxId:3899] [51524] (1 PDB entry)
    Cyanogenic beta-glucosidase
  8. 2083021Domain d1cbga_: 1cbg A: [28933]

Details for d1cbga_

PDB Entry: 1cbg (more details), 2.15 Å

PDB Description: the crystal structure of a cyanogenic beta-glucosidase from white clover (trifolium repens l.), a family 1 glycosyl-hydrolase
PDB Compounds: (A:) cyanogenic beta-glucosidase

SCOPe Domain Sequences for d1cbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]}
fkplpisfddfsdlnrscfapgfvfgtassafqyegaafedgkgpsiwdtfthkypekik
drtngdvaideyhrykedigimkdmnldayrfsiswprvlpkgklsggvnreginyynnl
inevlangmqpyvtlfhwdvpqaledeyrgflgrnivddfrdyaelcfkefgdrvkhwit
lnepwgvsmnayaygtfapgrcsdwlklnctggdsgrepylaahyqllahaaaarlyktk
yqasqngiigitlvshwfepaskekadvdaakrgldfmlgwfmhpltkgrypesmrylvr
krlpkfsteeskeltgsfdflglnyyssyyaakapripnarpaiqtdslinatfehngkp
lgpmaasswlciypqgirklllyvknhynnpviyitengrnefndptlslqeslldtpri
dyyyrhlyyvltaigdgvnvkgyfawslfdnmewdsgytvrfglvfvdfknnlkrhpkls
ahwfksflkk

SCOPe Domain Coordinates for d1cbga_:

Click to download the PDB-style file with coordinates for d1cbga_.
(The format of our PDB-style files is described here.)

Timeline for d1cbga_: