PDB entry 1cbg

View 1cbg on RCSB PDB site
Description: the crystal structure of a cyanogenic beta-glucosidase from white clover (trifolium repens l.), a family 1 glycosyl-hydrolase
Class: hydrolase (o-glycosyl)
Keywords: cyanogenic beta-glucosidase, hydrolase (o-glycosyl)
Deposited on 1995-07-31, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.195
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyanogenic beta-glucosidase
    Species: Trifolium repens [TaxId:3899]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1cbga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1cbgA (A:)
    fkplpisfddfsdlnrscfapgfvfgtassafqyegaafedgkgpsiwdtfthkypekik
    drtngdvaideyhrykedigimkdmnldayrfsiswprvlpkgklsggvnreginyynnl
    inevlangmqpyvtlfhwdvpqaledeyrgflgrnivddfrdyaelcfkefgdrvkhwit
    lnepwgvsmnayaygtfapgrcsdwlklnctggdsgrepylaahyqllahaaaarlyktk
    yqasqngiigitlvshwfepaskekadvdaakrgldfmlgwfmhpltkgrypesmrylvr
    krlpkfsteeskeltgsfdflglnyyssyyaakapripnarpaiqtdslinatfehngkp
    lgpmaasswlciypqgirklllyvknhynnpviyitengrnefndptlslqeslldtpri
    dyyyrhlyyvltaigdgvnvkgyfawslfdnmewdsgytvrfglvfvdfknnlkrhpkls
    ahwfksflkk