SCOP 1.65: Domain d2xyl__: 2xyl -

Lineage for d2xyl__ (2xyl -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.3: beta-glycanases [51487] (16 proteins)
   consist of a number of sequence families

6. Protein Xylanase A, catalytic core [51514] (6 species)

7. Species Cellulomonas fimi [TaxId:1708] [51520] (9 PDB entries)
   synonym: beta-1,4-glycanase Cex

8. Domain d2xyl__: 2xyl - [28917]
   complexed with x2f, xys

Details for d2xyl__

PDB Entry: 2xyl, 1.9 Å

PDB Description: cellulomonas fimi xylanase/cellulase complexed with 2-deoxy-2-fluoro- xylobiose

SCOP Domain Sequences for d2xyl__:

Sequence; same for both SEQRES and ATOM records:

>d2xyl__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

Timeline for d2xyl__:

• d2xyl__ first appeared (with stable ids) in SCOP 1.55
  
• d2xyl__ appears in SCOP 1.63
  
• d2xyl__ appears in SCOP 1.67
  
• d2xyl__ appears in the current release, SCOPe 2.08, called d2xyla_