Lineage for d2xyl__ (2xyl -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18969Protein Xylanase A, catalytic core [51514] (6 species)
  7. 18970Species Cellulomonas fimi [TaxId:1708] [51520] (8 PDB entries)
  8. 18978Domain d2xyl__: 2xyl - [28917]

Details for d2xyl__

PDB Entry: 2xyl (more details), 1.9 Å

PDB Description: cellulomonas fimi xylanase/cellulase complexed with 2-deoxy-2-fluoro- xylobiose

SCOP Domain Sequences for d2xyl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xyl__ c.1.8.3 (-) Xylanase A, catalytic core {Cellulomonas fimi}
attlkeaadgagrdfgfaldpnrlseaqykaiadsefnlvvaenamkwdatepsqnsfsf
gagdrvasyaadtgkelyghtlvwhsqlpdwaknlngsafesamvnhvtkvadhfegkva
swdvvneafadgggrrqdsafqqklgngyietafraaraadptaklcindynveginaks
nslydlvkdfkargvpldcvgfqshlivgqvpgdfrqnlqrfadlgvdvriteldirmrt
psdatklatqaadykkvvqacmqvtrcqgvtvwgitdkyswvpdvfpgegaalvwdasya
kkpayaavmeaf

SCOP Domain Coordinates for d2xyl__:

Click to download the PDB-style file with coordinates for d2xyl__.
(The format of our PDB-style files is described here.)

Timeline for d2xyl__: