SCOPe 2.08: Domain d1bhga3: 1bhg A:329-632

Lineage for d1bhga3 (1bhg A:329-632)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein beta-Glucuronidase, domain 3 [51512] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51513] (2 PDB entries)

8. Domain d1bhga3: 1bhg A:329-632 [28889]
   Other proteins in same PDB: d1bhga1, d1bhga2, d1bhgb1, d1bhgb2

Details for d1bhga3

PDB Entry: 1bhg, 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d1bhga3:

Sequence; same for both SEQRES and ATOM records:

>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

Timeline for d1bhga3:

• d1bhga3 first appeared (with stable ids) in SCOP 1.55
  
• d1bhga3 appears in SCOPe 2.07