Lineage for d1bhga3 (1bhg A:329-632)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18855Family c.1.8.3: beta-glycanases [51487] (12 proteins)
  6. 18902Protein beta-Glucuronidase, domain 3 [51512] (1 species)
  7. 18903Species Human (Homo sapiens) [TaxId:9606] [51513] (1 PDB entry)
  8. 18904Domain d1bhga3: 1bhg A:329-632 [28889]
    Other proteins in same PDB: d1bhga1, d1bhga2, d1bhgb1, d1bhgb2

Details for d1bhga3

PDB Entry: 1bhg (more details), 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

SCOP Domain Sequences for d1bhga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens)}
vavtksqflingkpfyfhgvnkhedadirgkgfdwpllvkdfnllrwlganafrtshypy
aeevmqmcdrygivvidecpgvglalpqffnnvslhhhmqvmeevvrrdknhpavvmwsv
anepashlesagyylkmviahtksldpsrpvtfvsnsnyaadkgapyvdviclnsyyswy
hdyghleliqlqlatqfenwykkyqkpiiqseygaetiagfhqdpplmfteeyqkslleq
yhlgldqkrrkyvvgeliwnfadfmteqsptrvlgnkkgiftrqrqpksaafllrerywk
iane

SCOP Domain Coordinates for d1bhga3:

Click to download the PDB-style file with coordinates for d1bhga3.
(The format of our PDB-style files is described here.)

Timeline for d1bhga3: