Lineage for d1bhga1 (1bhg A:226-328)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762431Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2762886Protein beta-Glucuronidase [49307] (1 species)
  7. 2762887Species Human (Homo sapiens) [TaxId:9606] [49308] (2 PDB entries)
  8. 2762892Domain d1bhga1: 1bhg A:226-328 [22161]
    Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3

Details for d1bhga1

PDB Entry: 1bhg (more details), 2.53 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d1bhga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhga1 b.1.4.1 (A:226-328) beta-Glucuronidase {Human (Homo sapiens) [TaxId: 9606]}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

SCOPe Domain Coordinates for d1bhga1:

Click to download the PDB-style file with coordinates for d1bhga1.
(The format of our PDB-style files is described here.)

Timeline for d1bhga1: