Lineage for d1bqca_ (1bqc A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970559Protein Beta-mannanase [51502] (4 species)
  7. 970562Species Thermobifida fusca [TaxId:2021] [51503] (3 PDB entries)
  8. 970563Domain d1bqca_: 1bqc A: [28831]

Details for d1bqca_

PDB Entry: 1bqc (more details), 1.5 Å

PDB Description: beta-mannanase from thermomonospora fusca
PDB Compounds: (A:) protein (beta-mannanase)

SCOPe Domain Sequences for d1bqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermobifida fusca [TaxId: 2021]}
atglhvkngrlyeangqefiirgvshphnwypqhtqafadikshgantvrvvlsngvrws
kngpsdvanvislckqnrlicmlevhdttgygeqsgastldqavdywielksvlqgeedy
vlinignepygndsatvaawatdtsaaiqrlraagfehtlvvdapnwgqdwtntmrnnad
qvyasdptgntvfsihmygvysqastitsylehfvnaglpliigefghdhsdgnpdedti
maeaerlklgyigwswsgngggveyldmvynfdgdnlspwgerifygpngiastakeavi
fg

SCOPe Domain Coordinates for d1bqca_:

Click to download the PDB-style file with coordinates for d1bqca_.
(The format of our PDB-style files is described here.)

Timeline for d1bqca_: