Lineage for d1xyza_ (1xyz A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein Xylanase [51488] (6 species) Species Clostridium thermocellum, XynZ [TaxId:1515] [51489] (1 PDB entry)
belongs to family F
Domain d1xyza_: 1xyz A: [28804]
Details for d1xyza_
PDB Entry: 1xyz (more details), 1.4 Å
PDB Description: a common protein fold and similar active site in two distinct families of beta-glycanases
PDB Compounds: (A:) 1,4-beta-d-xylan-xylanohydrolaseSCOPe Domain Sequences for d1xyza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]}
nalrdyaeargikigtcvnypfynnsdptynsilqrefsmvvcenemkfdalqprqnvfd
fskgdqllafaerngmqmrghtliwhnqnpswltngnwnrdsllavmknhittvmthykg
kivewdvanecmddsgnglrssiwrnvigqdyldyafryareadpdallfyndyniedlg
pksnavfnmiksmkergvpidgvgfqchfingmspeylasidqnikryaeigvivsftei
diripqsenpatafqvqannykelmkiclanpncntfvmwgftdkytwipgtfpgygnpl
iydsnynpkpaynaikealm
SCOPe Domain Coordinates for d1xyza_:
Click to download the PDB-style file with coordinates for d1xyza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xyza_:
- d1xyza_ first appeared (with stable ids) in SCOP 1.55
- d1xyza_ appears in SCOPe 2.07
View in 3D
