PDB entry 1xyz

View 1xyz on RCSB PDB site
Description: a common protein fold and similar active site in two distinct families of beta-glycanases
Class: glycosyltransferase
Keywords: glycosyl hydrolase, xylanase, family f/10 of glycosyl hydrolases, clostridium thermocellum, glycosyltransferase
Deposited on 1995-06-07, released 1996-01-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-12.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.183
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-d-xylan-xylanohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyza_
  • Chain 'B':
    Compound: 1,4-beta-d-xylan-xylanohydrolase
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xyzb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xyzA (A:)
    pgqgdvqtpnpsvtptqtpiptisgnalrdyaeargikigtcvnypfynnsdptynsilq
    refsmvvcenemkfdalqprqnvfdfskgdqllafaerngmqmrghtliwhnqnpswltn
    gnwnrdsllavmknhittvmthykgkivewdvanecmddsgnglrssiwrnvigqdyldy
    afryareadpdallfyndyniedlgpksnavfnmiksmkergvpidgvgfqchfingmsp
    eylasidqnikryaeigvivsfteidiripqsenpatafqvqannykelmkiclanpncn
    tfvmwgftdkytwipgtfpgygnpliydsnynpkpaynaikealmgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xyzA (A:)
    nalrdyaeargikigtcvnypfynnsdptynsilqrefsmvvcenemkfdalqprqnvfd
    fskgdqllafaerngmqmrghtliwhnqnpswltngnwnrdsllavmknhittvmthykg
    kivewdvanecmddsgnglrssiwrnvigqdyldyafryareadpdallfyndyniedlg
    pksnavfnmiksmkergvpidgvgfqchfingmspeylasidqnikryaeigvivsftei
    diripqsenpatafqvqannykelmkiclanpncntfvmwgftdkytwipgtfpgygnpl
    iydsnynpkpaynaikealm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xyzB (B:)
    pgqgdvqtpnpsvtptqtpiptisgnalrdyaeargikigtcvnypfynnsdptynsilq
    refsmvvcenemkfdalqprqnvfdfskgdqllafaerngmqmrghtliwhnqnpswltn
    gnwnrdsllavmknhittvmthykgkivewdvanecmddsgnglrssiwrnvigqdyldy
    afryareadpdallfyndyniedlgpksnavfnmiksmkergvpidgvgfqchfingmsp
    eylasidqnikryaeigvivsfteidiripqsenpatafqvqannykelmkiclanpncn
    tfvmwgftdkytwipgtfpgygnpliydsnynpkpaynaikealmgy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xyzB (B:)
    nalrdyaeargikigtcvnypfynnsdptynsilqrefsmvvcenemkfdalqprqnvfd
    fskgdqllafaerngmqmrghtliwhnqnpswltngnwnrdsllavmknhittvmthykg
    kivewdvanecmddsgnglrssiwrnvigqdyldyafryareadpdallfyndyniedlg
    pksnavfnmiksmkergvpidgvgfqchfingmspeylasidqnikryaeigvivsftei
    diripqsenpatafqvqannykelmkiclanpncntfvmwgftdkytwipgtfpgygnpl
    iydsnynpkpaynaikealm