Lineage for d1ehaa3 (1eha A:91-490)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830167Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
    contains an additional N-terminal domain
  7. 2830178Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (8 PDB entries)
  8. 2830186Domain d1ehaa3: 1eha A:91-490 [28773]
    Other proteins in same PDB: d1ehaa1, d1ehaa2
    has additional subdomain(s) that are not in the common domain

Details for d1ehaa3

PDB Entry: 1eha (more details), 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus
PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d1ehaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehaa3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekvgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

SCOPe Domain Coordinates for d1ehaa3:

Click to download the PDB-style file with coordinates for d1ehaa3.
(The format of our PDB-style files is described here.)

Timeline for d1ehaa3: