PDB entry 1eha

View 1eha on RCSB PDB site
Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus
Class: hydrolase
Keywords: trehalose, trehalohydrolase, Sulfolobus solfataricus, alpha-beta barrel, calcium binding, covalent dimer, crystal structure
Deposited on 2000-02-19, released 2001-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.205
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycosyltrehalose trehalohydrolase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q55088 (0-End)
      • mutation (297)
    Domains in SCOPe 2.07: d1ehaa1, d1ehaa2, d1ehaa3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ehaA (A:)
    tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
    ddaseipdpasryqpegvhgpsqiiqeskefnnetflkkedliiyeihvgtftpegtfeg
    virkldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkk
    glgvildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveyw
    ikeynvdgfrldavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekvgy
    nidaqwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgep
    vgeldgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeyg
    eenpfyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykil
    ikmrkelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpq
    hieegkyefdkgfalykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ehaA (A:)
    tfaykidgneviftlwapyqksvklkvlekglyemerdekgyftitlnnvkvrdrykyvl
    ddaseipdpasryqpegvhgpsqiiqeskefnnetflkkedliiyeihvgtftpegtfeg
    virkldylkdlgitaieimpiaqfpgkrdwgydgvylyavqnsyggpegfrklvdeahkk
    glgvildvvynhvgpegnymvklgpyfsqkyktpwgltfnfddaesdevrkfilenveyw
    ikeynvdgfrldavhaiidtspkhileeiadvvhkynriviaesdlndprvvnpkekvgy
    nidaqwvddfhhsihayltgerqgyytdfgnlddivksykdvfvydgkysnfrrkthgep
    vgeldgcnfvvyiqnhdqvgnrgkgeriiklvdresykiaaalyllspyipmifmgeeyg
    eenpfyffsdfsdskliqgvregrkkengqdtdpqdestfnasklswkideeifsfykil
    ikmrkelsiacdrrvnvvngenwliikgreyfslyvfskssievkysgtlllssnnsfpq
    hieegkyefdkgfalyk