Lineage for d1eo5a4 (1eo5 A:1-406)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 235645Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 236226Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 236227Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 236350Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 236360Species Bacillus circulans, different strains [TaxId:1397] [51453] (29 PDB entries)
  8. 236368Domain d1eo5a4: 1eo5 A:1-406 [28722]
    Other proteins in same PDB: d1eo5a1, d1eo5a2, d1eo5a3
    complexed with ca, glc, mpd; mutant

Details for d1eo5a4

PDB Entry: 1eo5 (more details), 2 Å

PDB Description: bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltoheptaose

SCOP Domain Sequences for d1eo5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo5a4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmaavkhmpfgwqk
sfmaavnnykpvftfgawflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1eo5a4:

Click to download the PDB-style file with coordinates for d1eo5a4.
(The format of our PDB-style files is described here.)

Timeline for d1eo5a4: