SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1eo5a4 (1eo5 A:1-406)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081720Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 2081721Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 2081732Domain d1eo5a4: 1eo5 A:1-406 [28722]
    Other proteins in same PDB: d1eo5a1, d1eo5a2, d1eo5a3
    complexed with ca, mpd

Details for d1eo5a4

PDB Entry: 1eo5 (more details), 2 Å

PDB Description: Bacillus circulans strain 251 cyclodextrin glycosyltransferase in complex with maltoheptaose
PDB Compounds: (A:) protein (cyclodextrin glycosyltransferase)

SCOPe Domain Sequences for d1eo5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo5a4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmaavkhmpfgwqk
sfmaavnnykpvftfgawflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiay

SCOPe Domain Coordinates for d1eo5a4:

Click to download the PDB-style file with coordinates for d1eo5a4.
(The format of our PDB-style files is described here.)

Timeline for d1eo5a4: