Lineage for d1ae4a_ (1ae4 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568129Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 1568236Species Pig (Sus scrofa) [TaxId:9823] [51438] (11 PDB entries)
  8. 1568246Domain d1ae4a_: 1ae4 A: [28689]
    complexed with nap, tol

Details for d1ae4a_

PDB Entry: 1ae4 (more details), 2.4 Å

PDB Description: aldehyde reductase complexed with cofactor and inhibitor, alpha carbon atoms only
PDB Compounds: (A:) aldehyde reductase

SCOPe Domain Sequences for d1ae4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ae4a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigealt
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsripqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy

SCOPe Domain Coordinates for d1ae4a_:

Click to download the PDB-style file with coordinates for d1ae4a_.
(The format of our PDB-style files is described here.)

Timeline for d1ae4a_: