SCOPe 2.08: Domain d1ae4a_: 1ae4 A:

Lineage for d1ae4a_ (1ae4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein Aldose reductase (aldehyde reductase) [51436] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51438] (12 PDB entries)

8. Domain d1ae4a_: 1ae4 A: [28689]
   complexed with nap, tol

Details for d1ae4a_

PDB Entry: 1ae4, 2.4 Å

PDB Description: aldehyde reductase complexed with cofactor and inhibitor, alpha carbon atoms only

PDB Compounds: (A:) aldehyde reductase

SCOPe Domain Sequences for d1ae4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ae4a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]}
aascvllhtgqkmpliglgtwksepgqvkaaikyaltvgyrhidcaaiygneleigealt
etvgpgkavpreelfvtsklwntkhhpedvepalrktladlqleyldlylmhwpyaferg
dnpfpknadgtirydathykdtwkalealvakglvralglsnfssrqiddvlsvasvrpa
vlqvechpylaqneliahcqarglevtaysplgssdrawrdpnepvlleepvvqalaeky
nrspaqillrwqvqrkvicipksvtpsripqniqvfdftfspeemkqldalnknlrfivp
mltvdgkrvprdaghplypfndpy

Timeline for d1ae4a_:

• d1ae4a_ first appeared (with stable ids) in SCOP 1.55, called d1ae4__
  
• d1ae4a_ appears in SCOPe 2.07