| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.6: PLP-binding barrel [51419] (2 families) ![]() circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
| Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins) |
| Protein Alanine racemase [51421] (3 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries) |
| Domain d1bd0b2: 1bd0 B:12-244 [28643] Other proteins in same PDB: d1bd0a1, d1bd0b1 complexed with in5 |
PDB Entry: 1bd0 (more details), 1.6 Å
SCOPe Domain Sequences for d1bd0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bd0b2 c.1.6.1 (B:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]}
vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal
alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd
tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew
lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d1bd0b2: